PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.08G151900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family WOX
Protein Properties Length: 255aa    MW: 27731.9 Da    PI: 6.6338
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.08G151900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox48.81.2e-152484257
                         T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                         r+R+t+++eq+ +Le+ F++   +p ++e  ++ k l    ++ +++V++WFqNrR + ++
  Manes.08G151900.1.p 24 RSRWTPKPEQILILESIFNSgMVNPPKDETVRIRKLLekfgSVGDANVFYWFQNRRSRSRR 84
                         89*****************99*************************************997 PP

2Wus_type_Homeobox107.48.4e-352386265
    Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                         +r+RWtP+peQi iLe++++sG+++P+k+e+ ri++ Le++G ++d+NVfyWFQNr++R+r++q
  Manes.08G151900.1.p 23 VRSRWTPKPEQILILESIFNSGMVNPPKDETVRIRKLLEKFGSVGDANVFYWFQNRRSRSRRRQ 86
                         589***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.28E-141991IPR009057Homeodomain-like
PROSITE profilePS5007111.4342085IPR001356Homeobox domain
SMARTSM003896.6E-72289IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.4E-92390IPR009057Homeodomain-like
PfamPF000462.3E-132484IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MEDNQGQFLN SPGHHGTERS EPVRSRWTPK PEQILILESI FNSGMVNPPK DETVRIRKLL  60
EKFGSVGDAN VFYWFQNRRS RSRRRQRQMQ ASLAEAQRNQ QAQASGGVIQ YEGGSGGSSG  120
GSSSLMGFAN SSSFAVSPYH VGSSSSCGIF GHEDGVANLF PMPNQMGFQE IEHGSSISSI  180
LSPSETSNFG GFITVFINGV PTEVPRGPLD MKAMFGQDVM LVHSSGVILP SNEYGFLMES  240
LQHGESYFLV SRPT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002525671.21e-124PREDICTED: WUSCHEL-related homeobox 11 isoform X1
RefseqXP_015578806.11e-124PREDICTED: WUSCHEL-related homeobox 11 isoform X1
SwissprotQ6X7J36e-72WOX11_ARATH; WUSCHEL-related homeobox 11
TrEMBLB9SI521e-121B9SI52_RICCO; Protein WUSCHEL, putative
STRINGPOPTR_0013s06310.11e-111(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF58983152
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03660.15e-63WUSCHEL related homeobox 11